Lineage for d3qq7a2 (3qq7 A:107-187)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) 
Family d.31.1.1: Cdc48 domain 2-like [54586] (4 proteins) Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species) Species Human (Homo sapiens) [TaxId:9606] [233318] (6 PDB entries) 
Domain d3qq7a2: 3qq7 A:107-187 [233349]
Other proteins in same PDB: d3qq7a1
automated match to d1e32a3
complexed with cl, co, gol, hez
Details for d3qq7a2
PDB Entry: 3qq7 (more details), 2.65 Å
PDB Description: crystal structure of the p97 n-terminal domain
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPaseSCOPe Domain Sequences for d3qq7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq7a2 d.31.1.1 (A:107-187) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcege
SCOPe Domain Coordinates for d3qq7a2:
Click to download the PDB-style file with coordinates for d3qq7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qq7a2:
- d3qq7a2 first appeared in SCOPe 2.03
- d3qq7a2 appears in SCOPe 2.04
- d3qq7a2 appears in SCOPe 2.06
- d3qq7a2 appears in the current release, SCOPe 2.08
View in 3D
