Lineage for d3qq7a1 (3qq7 A:20-106)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins) Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species) Species Human (Homo sapiens) [TaxId:9606] [233316] (13 PDB entries) 
Domain d3qq7a1: 3qq7 A:20-106 [233348]
Other proteins in same PDB: d3qq7a2
automated match to d1e32a1
complexed with cl, co, gol, hez
Details for d3qq7a1
PDB Entry: 3qq7 (more details), 2.65 Å
PDB Description: crystal structure of the p97 n-terminal domain
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPaseSCOPe Domain Sequences for d3qq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq7a1 b.52.2.3 (A:20-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
knrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsd
ekirmnrvvrnnlrvrlgdvisiqpcp
SCOPe Domain Coordinates for d3qq7a1:
Click to download the PDB-style file with coordinates for d3qq7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qq7a1:
- d3qq7a1 first appeared in SCOPe 2.03
- d3qq7a1 appears in SCOPe 2.07
View in 3D
