SCOPe 2.05: Domain d3qpqc1: 3qpq C:1-107

Lineage for d3qpqc1 (3qpq C:1-107)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (26 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
Domain d3qpqc1: 3qpq C:1-107 [215349]
Other proteins in same PDB: d3qpqc2, d3qpqe2, d3qpqi2, d3qpql2
automated match to d1rhha1
complexed with gol, so4

Details for d3qpqc1

PDB Entry: 3qpq (more details), 1.9 Å

PDB Description: crystal structure of anti-tlr3 antibody c1068 fab

PDB Compounds: (C:) C1068 light chain

SCOPe Domain Sequences for d3qpqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpqc1 b.1.1.0 (C:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsgsesgtqyslkinslqpedfgsyycqhfwstpftfgsgtklelk

SCOPe Domain Coordinates for d3qpqc1:

Click to download the PDB-style file with coordinates for d3qpqc1.
(The format of our PDB-style files is described here.)

Timeline for d3qpqc1: