Lineage for d3qp3c_ (3qp3 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764763Protein Titin [49172] (1 species)
  7. 1764764Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (7 PDB entries)
  8. 1764767Domain d3qp3c_: 3qp3 C: [196030]
    automated match to d1g1ca_
    complexed with so4

Details for d3qp3c_

PDB Entry: 3qp3 (more details), 2 Å

PDB Description: Crystal structure of titin domain M4, tetragonal form
PDB Compounds: (C:) titin

SCOPe Domain Sequences for d3qp3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qp3c_ b.1.1.4 (C:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
tldhapritlrmrshrvpcgqntrfilnvqskptaevkwyhngvelqesskihytntsgv
ltleildchtddsgtyravctnykgeasdyatldvtg

SCOPe Domain Coordinates for d3qp3c_:

Click to download the PDB-style file with coordinates for d3qp3c_.
(The format of our PDB-style files is described here.)

Timeline for d3qp3c_: