Lineage for d3qnla_ (3qnl A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068
Protein automated matches [190139] (27 species)
not a true protein
Species Bothrops pirajai [TaxId:113192] [188615] (4 PDB entries) 
Domain d3qnla_: 3qnl A: [191943]
automated match to d2ok9a_
complexed with ipa, p33, roa
Details for d3qnla_
PDB Entry: 3qnl (more details), 1.77 Å
PDB Description: Crystal structure of PrTX-I complexed to Rosmarinic Acid
PDB Compounds: (A:) Phospholipase A2 homolog 1SCOPe Domain Sequences for d3qnla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qnla_ a.133.1.2 (A:) automated matches {Bothrops pirajai [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynklyryhlkpfckkadd
c
SCOPe Domain Coordinates for d3qnla_:
Click to download the PDB-style file with coordinates for d3qnla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qnla_:
- d3qnla_ first appeared in SCOPe 2.02
- d3qnla_ appears in SCOPe 2.06
- d3qnla_ appears in the current release, SCOPe 2.08
View in 3D
