SCOPe 2.07: Domain d3qjhd2: 3qjh D:120-246

Lineage for d3qjhd2 (3qjh D:120-246)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d3qjhd2: 3qjh D:120-246 [215276]
Other proteins in same PDB: d3qjha1, d3qjhb1, d3qjhc1, d3qjhd1
automated match to d1qsee2

Details for d3qjhd2

PDB Entry: 3qjh (more details), 1.9 Å

PDB Description: The crystal structure of the 5c.c7 TCR

PDB Compounds: (D:) 5c.c7 beta chain

SCOPe Domain Sequences for d3qjhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjhd2 b.1.1.2 (D:120-246) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d3qjhd2:

Click to download the PDB-style file with coordinates for d3qjhd2.
(The format of our PDB-style files is described here.)

Timeline for d3qjhd2: