Lineage for d3qj3a_ (3qj3 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheetFamily d.3.1.0: automated matches [191342] (1 protein)
not a true familyProtein automated matches [190230] (23 species)
not a true protein
Species Yellow mealworm (Tenebrio molitor) [TaxId:7067] [189891] (2 PDB entries) 
Domain d3qj3a_: 3qj3 A: [184410]
automated match to d7pcka_
complexed with act
Details for d3qj3a_
PDB Entry: 3qj3 (more details), 1.85 Å
PDB Description: structure of digestive procathepsin l2 proteinase from tenebrio molitor larval midgut
PDB Compounds: (A:) Cathepsin L-like proteinSCOPe Domain Sequences for d3qj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qj3a_ d.3.1.0 (A:) automated matches {Yellow mealworm (Tenebrio molitor) [TaxId: 7067]}
lpstfvaekwenfkttyarsyvnakeetfrkqifqkkletfeehnekyrqglvsytlgvn
lftdmtpeemkaythglimpadlhkngipiktredlglnasvrypasfdwrdqgmvspvk
nqgscgsswafsstgaiesqmkiangagydssvseqqlvdcvpnalgcsggwmndaftyv
aqnggidsegaypyemadgnchydpnqvaarlsgyvylsgpdenmladmvatkgpvavaf
daddpfgsysggvyynptcetnkfthavlivgygnengqdywlvknswgdgwgldgyfki
arnannhcgiagvasvptl
SCOPe Domain Coordinates for d3qj3a_:
Click to download the PDB-style file with coordinates for d3qj3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qj3a_:
- d3qj3a_ first appeared in SCOPe 2.01
- d3qj3a_ appears in SCOPe 2.07
View in 3D
