Lineage for d3qgva2 (3qgv A:362-435)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.0: automated matches [227134] (1 protein)
not a true familyProtein automated matches [226835] (41 species)
not a true protein
Species Pyrococcus woesei [TaxId:2262] [226293] (1 PDB entry) 
Domain d3qgva2: 3qgv A:362-435 [215225]
Other proteins in same PDB: d3qgva1
automated match to d1mwoa1
complexed with ca, so4, trs, zn
Details for d3qgva2
PDB Entry: 3qgv (more details), 2.1 Å
PDB Description: crystal structure of a thermostable amylase variant
PDB Compounds: (A:) alpha amylaseSCOPe Domain Sequences for d3qgva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qgva2 b.71.1.0 (A:362-435) automated matches {Pyrococcus woesei [TaxId: 2262]}
pglityinlgsskagrwvyvpkfagaciheytgnlggwvdkyvyssgwvyleapaydpan
gqygysvwsycgvg
SCOPe Domain Coordinates for d3qgva2:
Click to download the PDB-style file with coordinates for d3qgva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qgva2:
- d3qgva2 first appeared in SCOPe 2.03
- d3qgva2 appears in SCOPe 2.07
View in 3D
