Lineage for d3qbqa_ (3qbq A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.22: TNF-like [49841] (1 superfamily)
sandwich, 10 strands in 2 sheets; jelly-rollSuperfamily b.22.1: TNF-like [49842] (2 families) 
Family b.22.1.1: TNF-like [49843] (15 proteins) 
Protein TRANCE/RANKL cytokine [63721] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries) 
Domain d3qbqa_: 3qbq A: [184324]
automated match to d1iqaa_
Details for d3qbqa_
PDB Entry: 3qbq (more details), 2.5 Å
PDB Description: crystal structure of extracellular domains of mouse rank-rankl complex
PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11SCOPe Domain Sequences for d3qbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qbqa_ b.22.1.1 (A:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdi
SCOPe Domain Coordinates for d3qbqa_:
Click to download the PDB-style file with coordinates for d3qbqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qbqa_:
- d3qbqa_ first appeared in SCOPe 2.01
- d3qbqa_ appears in SCOPe 2.06
- d3qbqa_ appears in the current release, SCOPe 2.08
View in 3D
