Class b: All beta proteins [48724] (178 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein TRANCE/RANKL cytokine [63721] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63722] (6 PDB entries) |
Domain d3qbqa_: 3qbq A: [184324] automated match to d1iqaa_ |
PDB Entry: 3qbq (more details), 2.5 Å
SCOPe Domain Sequences for d3qbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qbqa_ b.22.1.1 (A:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]} aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff klrageeisiqvsnpslldpdqdatyfgafkvqdi
Timeline for d3qbqa_: