Lineage for d3q9va_ (3q9v A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY familyFamily a.4.6.0: automated matches [191513] (1 protein)
not a true familyProtein automated matches [190858] (25 species)
not a true protein
Species Deinococcus radiodurans [TaxId:1299] [226279] (2 PDB entries) 
Domain d3q9va_: 3q9v A: [248810]
automated match to d2pmub_
Details for d3q9va_
PDB Entry: 3q9v (more details), 1.6 Å
PDB Description: crystal structure of rra c-terminal domain(123-221) from deinococcus radiodurans
PDB Compounds: (A:) DNA-binding response regulatorSCOPe Domain Sequences for d3q9va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9va_ a.4.6.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
eslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrlp
egsnvvdvhmanlraklrdldgygllrtvrgvgyalrg
SCOPe Domain Coordinates for d3q9va_:
Click to download the PDB-style file with coordinates for d3q9va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q9va_:
- d3q9va_ first appeared in SCOPe 2.04
- d3q9va_ appears in SCOPe 2.07
View in 3D
