Lineage for d3q9nc_ (3q9n C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229098Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1229099Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1229100Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1229189Protein automated matches [190101] (6 species)
    not a true protein
  7. 1229198Species Escherichia coli [TaxId:562] [189927] (2 PDB entries)
  8. 1229199Domain d3q9nc_: 3q9n C: [184292]
    Other proteins in same PDB: d3q9na_, d3q9nb_
    automated match to d1awcb_
    complexed with cms, coa

Details for d3q9nc_

PDB Entry: 3q9n (more details), 2 Å

PDB Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
PDB Compounds: (C:) consensus ankyrin repeat

SCOPe Domain Sequences for d3q9nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9nc_ d.211.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
fgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllkn
gadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqleiv
evllkhgadvnaqdalgltafdisinqgqedlaeilq

SCOPe Domain Coordinates for d3q9nc_:

Click to download the PDB-style file with coordinates for d3q9nc_.
(The format of our PDB-style files is described here.)

Timeline for d3q9nc_: