Lineage for d3q95b_ (3q95 B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) Protein automated matches [190059] (14 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries) 
Domain d3q95b_: 3q95 B: [184283]
automated match to d1qkua_
complexed with cl, esl
Details for d3q95b_
PDB Entry: 3q95 (more details), 2.05 Å
PDB Description: Crystal structure of human estrogen receptor alpha LBD in complex with GRIP peptide and estriol
PDB Compounds: (B:) Estrogen receptorSCOPe Domain Sequences for d3q95b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q95b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
wakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcve
gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdl
llemldahrlhap
SCOPe Domain Coordinates for d3q95b_:
Click to download the PDB-style file with coordinates for d3q95b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q95b_:
- d3q95b_ first appeared in SCOPe 2.01
- d3q95b_ appears in SCOPe 2.06
- d3q95b_ appears in the current release, SCOPe 2.08
View in 3D
