Lineage for d3q90b_ (3q90 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405776Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1405777Protein automated matches [190205] (13 species)
    not a true protein
  7. 1405789Species Human (Homo sapiens) [TaxId:9606] [189642] (3 PDB entries)
  8. 1405793Domain d3q90b_: 3q90 B: [184279]
    automated match to d1zo2a1

Details for d3q90b_

PDB Entry: 3q90 (more details), 1.7 Å

PDB Description: Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1
PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d3q90b_:

Sequence, based on SEQRES records: (download)

>d3q90b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqk
eihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegs
vankfyvhndifryqdevfg

Sequence, based on observed residues (ATOM records): (download)

>d3q90b_ d.17.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldpadavygqkeihr
kvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapefyvhnd
ifryqdevfg

SCOPe Domain Coordinates for d3q90b_:

Click to download the PDB-style file with coordinates for d3q90b_.
(The format of our PDB-style files is described here.)

Timeline for d3q90b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3q90a_