Lineage for d3q80a_ (3q80 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the restSuperfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) 
Family c.68.1.0: automated matches [191551] (1 protein)
not a true familyProtein automated matches [190951] (34 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries) 
Domain d3q80a_: 3q80 A: [184270]
automated match to d1vpaa_
complexed with cdm, cl, mg
Details for d3q80a_
PDB Entry: 3q80 (more details), 2 Å
PDB Description: structure of mtb 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) complexed with cdp-me
PDB Compounds: (A:) 2-C-methyl-D-erythritol 4-phosphate cytidyltransferaseSCOPe Domain Sequences for d3q80a_:
Sequence, based on SEQRES records: (download)
>d3q80a_ c.68.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtde
arqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvveal
rdgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsldl
paaeytddaslvehiggqvqvvdgdplafkittkldlllaqaivrg
Sequence, based on observed residues (ATOM records): (download)
>d3q80a_ c.68.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtde
arqilghramivaggsnrtdtvnlaltvlsepefvlvhdaaraltppalvarvvealrdg
yaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsleytdd
aslvehiggqvqvvdgdplafkittkldlllaqaivrg
SCOPe Domain Coordinates for d3q80a_:
Click to download the PDB-style file with coordinates for d3q80a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q80a_:
- d3q80a_ first appeared in SCOPe 2.01
- d3q80a_ appears in SCOPe 2.07
View in 3D
