Lineage for d3q7hc_ (3q7h C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112073Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2112253Protein automated matches [190149] (9 species)
    not a true protein
  7. 2112297Species Coxiella burnetii [TaxId:360115] [189606] (1 PDB entry)
  8. 2112300Domain d3q7hc_: 3q7h C: [184246]
    automated match to d1tyfa_
    complexed with ca, peg

Details for d3q7hc_

PDB Entry: 3q7h (more details), 2.5 Å

PDB Description: Structure of the ClpP subunit of the ATP-dependent Clp Protease from Coxiella burnetii
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3q7hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7hc_ c.14.1.1 (C:) automated matches {Coxiella burnetii [TaxId: 360115]}
vpmvveqtsrgeraydiysrllkdrviflvgqvedhmanlaiaqmlflesenpnkdinly
inspggavtsamaiydtmqfvkpdvrtlcigqaasagalllaggakgkrhclphssvmih
qvlggyqgqgtdiqihakqtqrvsdqlnqilakhtgkdiervekdtnrdyfltpeeavey
glidsifkerp

SCOPe Domain Coordinates for d3q7hc_:

Click to download the PDB-style file with coordinates for d3q7hc_.
(The format of our PDB-style files is described here.)

Timeline for d3q7hc_: