SCOPe 2.05: Domain d3q5ya1: 3q5y A:0-117

Lineage for d3q5ya1 (3q5y A:0-117)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (26 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
Domain d3q5ya1: 3q5y A:0-117 [215070]
Other proteins in same PDB: d3q5ya2, d3q5yb2, d3q5yc2, d3q5yd2
automated match to d1lp9f1
complexed with epe, gol, peg

Details for d3q5ya1

PDB Entry: 3q5y (more details), 1.9 Å

PDB Description: V beta/V beta homodimerization-based pre-TCR model suggested by TCR beta crystal structures

PDB Compounds: (A:) TCR N15 beta

SCOPe Domain Sequences for d3q5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5ya1 b.1.1.0 (A:0-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle

SCOPe Domain Coordinates for d3q5ya1:

Click to download the PDB-style file with coordinates for d3q5ya1.
(The format of our PDB-style files is described here.)

Timeline for d3q5ya1: