Lineage for d3q5ya1 (3q5y A:0-117)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766765Domain d3q5ya1: 3q5y A:0-117 [215070]
    Other proteins in same PDB: d3q5ya2, d3q5yb2, d3q5yc2, d3q5yd2
    automated match to d1lp9f1
    complexed with epe, gol, peg

Details for d3q5ya1

PDB Entry: 3q5y (more details), 1.9 Å

PDB Description: V beta/V beta homodimerization-based pre-TCR model suggested by TCR beta crystal structures
PDB Compounds: (A:) TCR N15 beta

SCOPe Domain Sequences for d3q5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q5ya1 b.1.1.0 (A:0-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf
lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle

SCOPe Domain Coordinates for d3q5ya1:

Click to download the PDB-style file with coordinates for d3q5ya1.
(The format of our PDB-style files is described here.)

Timeline for d3q5ya1: