Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [191079] (5 species) not a true protein |
Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries) |
Domain d3q5va_: 3q5v A: [184223] automated match to d1twla_ complexed with mg, so4 |
PDB Entry: 3q5v (more details), 1.29 Å
SCOPe Domain Sequences for d3q5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q5va_ b.40.5.1 (A:) automated matches {Thermococcus thioreducens [TaxId: 277988]} mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
Timeline for d3q5va_: