Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator SlyA [81688] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [158271] (3 PDB entries) Uniprot P40676 1-140 |
Domain d3q5fa_: 3q5f A: [184218] automated match to d3deua1 protein/DNA complex |
PDB Entry: 3q5f (more details), 2.96 Å
SCOPe Domain Sequences for d3q5fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q5fa_ a.4.5.28 (A:) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} esplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqp slvrtldqledkglisrqtcasdrrakrikltekaepliaemeevihktrgeilagisse eiellikliaklehnimelhs
Timeline for d3q5fa_: