Lineage for d3q29c_ (3q29 C:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) 
Protein automated matches [190140] (38 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries) 
Domain d3q29c_: 3q29 C: [184166]
automated match to d1a7la_
complexed with gol, mal, so4
Details for d3q29c_
PDB Entry: 3q29 (more details), 2.3 Å
PDB Description: cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (mbp)
PDB Compounds: (C:) Maltose-binding periplasmic protein/alpha-synuclein chimeric proteinSCOPe Domain Sequences for d3q29c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q29c_ c.94.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtnsssmdvfmkglskakeg
SCOPe Domain Coordinates for d3q29c_:
Click to download the PDB-style file with coordinates for d3q29c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q29c_:
- d3q29c_ first appeared in SCOPe 2.01
- d3q29c_ appears in SCOPe 2.06
- d3q29c_ appears in the current release, SCOPe 2.08
View in 3D
