Lineage for d3pxka_ (3pxk A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein automated matches [190091] (13 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries) 
Domain d3pxka_: 3pxk A: [184059]
automated match to d1mp8a_
complexed with pxk, so4
Details for d3pxka_
PDB Entry: 3pxk (more details), 1.79 Å
PDB Description: focal adhesion kinase catalytic domain in complex with pyrrolo[2,3- d]thiazole
PDB Compounds: (A:) PTK2 proteinSCOPe Domain Sequences for d3pxka_:
Sequence, based on SEQRES records: (download)
>d3pxka_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapesi
nfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlysl
mtkcwaydpsrrprftelkaqlstileeekaqq
Sequence, based on observed residues (ATOM records): (download)
>d3pxka_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvssndcvklgdfglpikwmapesinfrrftsasdvwmfgvc
mweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprfte
lkaqlstileeekaqq
SCOPe Domain Coordinates for d3pxka_:
Click to download the PDB-style file with coordinates for d3pxka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pxka_:
- d3pxka_ first appeared in SCOPe 2.01
- d3pxka_ appears in SCOPe 2.03
- d3pxka_ appears in SCOPe 2.05
- d3pxka_ appears in the current release, SCOPe 2.08
View in 3D
