Lineage for d3pvaa_ (3pva A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224747Family d.153.1.3: Penicillin V acylase [56248] (2 proteins)
    automatically mapped to Pfam PF02275
  6. 2224748Protein Penicillin V acylase [56249] (1 species)
  7. 2224749Species Bacillus sphaericus [TaxId:1421] [56250] (2 PDB entries)
  8. 2224754Domain d3pvaa_: 3pva A: [41854]

Details for d3pvaa_

PDB Entry: 3pva (more details), 2.8 Å

PDB Description: penicillin v acylase from b. sphaericus
PDB Compounds: (A:) protein (penicillin v acylase)

SCOPe Domain Sequences for d3pvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvaa_ d.153.1.3 (A:) Penicillin V acylase {Bacillus sphaericus [TaxId: 1421]}
csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst
ditspvlydgvnekglmgamlyyatfatyadepkkgttginpvyvisqvlgncvtvddvi
ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnspgye
whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte
kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris
avslmaenlnsqdlitfewdrkqdikqlnqvnvm

SCOPe Domain Coordinates for d3pvaa_:

Click to download the PDB-style file with coordinates for d3pvaa_.
(The format of our PDB-style files is described here.)

Timeline for d3pvaa_: