Lineage for d3pu7b_ (3pu7 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) 
has additional strand at N-terminusFamily b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) Protein automated matches [190916] (13 species)
not a true protein
Species Solanum lycopersicum [TaxId:4081] [196089] (6 PDB entries) 
Domain d3pu7b_: 3pu7 B: [196090]
automated match to d1srda_
complexed with cu, zn
Details for d3pu7b_
PDB Entry: 3pu7 (more details), 1.8 Å
PDB Description: Cu-Zn Tomato Chloroplast Superoxide Dismutase
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn], chloroplasticSCOPe Domain Sequences for d3pu7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pu7b_ b.1.8.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atkkavavlkgnsnvegvvtlsqdddgpttvnvritglapglhgfhlheygdttngcmst
gahfnpnklthgapgdeirhagdlgnivanadgvaevtlvdnqipltgpnsvvgralvvh
eleddlgkgghelslttgnaggrlacgvvgltpi
SCOPe Domain Coordinates for d3pu7b_:
Click to download the PDB-style file with coordinates for d3pu7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pu7b_:
- d3pu7b_ first appeared in SCOPe 2.02
- d3pu7b_ appears in SCOPe 2.07
View in 3D
