SCOPe 2.08: Domain d3pqfa1: 3pqf A:2-147

Lineage for d3pqfa1 (3pqf A:2-147)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.0: automated matches [191313] (1 protein)
not a true family
Protein automated matches [190069] (319 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries)
Domain d3pqfa1: 3pqf A:2-147 [214925]
Other proteins in same PDB: d3pqfa2, d3pqfb2, d3pqfc2, d3pqfd2
automated match to d1llca1
complexed with nad; mutant

Details for d3pqfa1

PDB Entry: 3pqf (more details), 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqfa1 c.2.1.0 (A:2-147) automated matches {Bacillus subtilis [TaxId: 1423]}
nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
tnpvdiltyatwkfsglpkervigsg

SCOPe Domain Coordinates for d3pqfa1:

Click to download the PDB-style file with coordinates for d3pqfa1.
(The format of our PDB-style files is described here.)

Timeline for d3pqfa1: