Lineage for d3pnlb_ (3pnl B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285629Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 1285630Superfamily a.208.1: DhaL-like [101473] (2 families) (S)
  5. 1285642Family a.208.1.0: automated matches [191401] (1 protein)
    not a true family
  6. 1285643Protein automated matches [190529] (2 species)
    not a true protein
  7. 1285644Species Escherichia coli K-12 [TaxId:83333] [189603] (2 PDB entries)
  8. 1285645Domain d3pnlb_: 3pnl B: [183875]
    Other proteins in same PDB: d3pnla_
    automated match to d3cr3a1
    complexed with adp, gol, mg

Details for d3pnlb_

PDB Entry: 3pnl (more details), 2.2 Å

PDB Description: crystal structure of e.coli dha kinase dhak-dhal complex
PDB Compounds: (B:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOPe Domain Sequences for d3pnlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pnlb_ a.208.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gsslsrtqivnwltrcgdifsteseyltgldreigdadhglnmnrgfskvveklpaiadk
digfilkntgmtllssvggasgplfgtffiraaqatqarqsltleelyqmfrdgadgvis
rgkaepgdktmcdvwvpvveslrqsseqnlsvpvaleaassiaesaaqstitmqarkgra
sylgersighqdpgatsvmfmmqmlalaake

SCOPe Domain Coordinates for d3pnlb_:

Click to download the PDB-style file with coordinates for d3pnlb_.
(The format of our PDB-style files is described here.)

Timeline for d3pnlb_: