Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
Protein automated matches [226892] (5 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [233241] (1 PDB entry) |
Domain d3phta2: 3pht A:61-144 [233242] Other proteins in same PDB: d3phta1 automated match to d2bj9a2 complexed with ni; mutant |
PDB Entry: 3pht (more details), 2.04 Å
SCOPe Domain Sequences for d3phta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3phta2 d.58.18.0 (A:61-144) automated matches {Helicobacter pylori [TaxId: 210]} deskiavlvviydahqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei qrlqleigglrgvkfakltkassf
Timeline for d3phta2: