Lineage for d3phsa1 (3phs A:31-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769819Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2769820Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2769831Protein Gram-positive bacterial pilin domains [310720] (2 species)
  7. 2769837Species Streptococcus agalactiae [TaxId:208435] [310966] (1 PDB entry)
  8. 2769838Domain d3phsa1: 3phs A:31-150 [306238]
    Other proteins in same PDB: d3phsa3

Details for d3phsa1

PDB Entry: 3phs (more details), 1.8 Å

PDB Description: Crystal Structure of GBS52, the minor pilin in gram-positive pathogen Streptococcus agalactiae
PDB Compounds: (A:) cell wall surface anchor family protein

SCOPe Domain Sequences for d3phsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phsa1 b.3.5.1 (A:31-150) Gram-positive bacterial pilin domains {Streptococcus agalactiae [TaxId: 208435]}
hqltivhleardidrpnpqleiapkegtpiegvlyqlyqlkstedgdllahwnsltitel
kkqaqqvfeattnqqgkatfnqlpdgiyyglavkageknrnvsaflvdlsedkviypkii

SCOPe Domain Coordinates for d3phsa1:

Click to download the PDB-style file with coordinates for d3phsa1.
(The format of our PDB-style files is described here.)

Timeline for d3phsa1: