Lineage for d3pgfl1 (3pgf L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367151Domain d3pgfl1: 3pgf L:1-107 [214768]
    Other proteins in same PDB: d3pgfa_, d3pgfl2
    automated match to d1rhha1
    complexed with glc, gol, imd

Details for d3pgfl1

PDB Entry: 3pgf (more details), 2.1 Å

PDB Description: crystal structure of maltose bound mbp with a conformationally specific synthetic antigen binder (sab)
PDB Compounds: (L:) SAB Light Chain

SCOPe Domain Sequences for d3pgfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgfl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqssyipvtfgqgtkveik

SCOPe Domain Coordinates for d3pgfl1:

Click to download the PDB-style file with coordinates for d3pgfl1.
(The format of our PDB-style files is described here.)

Timeline for d3pgfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pgfl2
View in 3D
Domains from other chains:
(mouse over for more information)
d3pgfa_