Lineage for d3pf3a_ (3pf3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435190Species Giardia intestinalis [TaxId:5741] [187625] (8 PDB entries)
  8. 2435196Domain d3pf3a_: 3pf3 A: [183691]
    automated match to d1i45a_
    complexed with ca, gol, so4; mutant

Details for d3pf3a_

PDB Entry: 3pf3 (more details), 2.1 Å

PDB Description: Crystal structure of a mutant (C202A) of Triosephosphate isomerase from Giardia lamblia derivatized with MMTS
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3pf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pf3a_ c.1.1.0 (A:) automated matches {Giardia intestinalis [TaxId: 5741]}
parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsnceklgqcpnidgflvggasl
kpefmtmidiltktrt

SCOPe Domain Coordinates for d3pf3a_:

Click to download the PDB-style file with coordinates for d3pf3a_.
(The format of our PDB-style files is described here.)

Timeline for d3pf3a_: