Lineage for d3pela_ (3pel A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686304Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries)
  8. 2686305Domain d3pela_: 3pel A: [183685]
    Other proteins in same PDB: d3pelb_
    automated match to d1fhja_
    complexed with hem

Details for d3pela_

PDB Entry: 3pel (more details), 1.9 Å

PDB Description: Structure of Greyhound Hemoglobin: Origin of High Oxygen Affinity
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3pela_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pela_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

SCOPe Domain Coordinates for d3pela_:

Click to download the PDB-style file with coordinates for d3pela_.
(The format of our PDB-style files is described here.)

Timeline for d3pela_: