Lineage for d3pd8c_ (3pd8 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879268Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 1879277Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)
  8. 1879550Domain d3pd8c_: 3pd8 C: [183665]
    automated match to d1mm6a_
    complexed with acy, cac, gol, ha7, zn

Details for d3pd8c_

PDB Entry: 3pd8 (more details), 2.48 Å

PDB Description: x-ray structure of the ligand-binding core of glua2 in complex with (s)-7-hpca at 2.5 a resolution
PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d3pd8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pd8c_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
anktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkl
neqglldklknkwwydkgec

SCOPe Domain Coordinates for d3pd8c_:

Click to download the PDB-style file with coordinates for d3pd8c_.
(The format of our PDB-style files is described here.)

Timeline for d3pd8c_: