![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Surfactant protein, lectin domain [56461] (3 species) |
![]() | Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (15 PDB entries) |
![]() | Domain d3pbfa2: 3pbf A:110-228 [214753] Other proteins in same PDB: d3pbfa1 automated match to d1r13a1 complexed with ca, gol |
PDB Entry: 3pbf (more details), 1.8 Å
SCOPe Domain Sequences for d3pbfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pbfa2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]} smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef
Timeline for d3pbfa2: