Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein Bile acid receptor FXR [101433] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries) |
Domain d3p88a_: 3p88 A: [196194] automated match to d3ruua_ complexed with p88, so4 |
PDB Entry: 3p88 (more details), 2.95 Å
SCOPe Domain Sequences for d3p88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p88a_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfeiltematnhvqvlveftk klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiwdvq
Timeline for d3p88a_: