Lineage for d3p7gb_ (3p7g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002363Domain d3p7gb_: 3p7g B: [214675]
    Other proteins in same PDB: d3p7ga2, d3p7gc2
    automated match to d2ziba_
    complexed with ca, man

Details for d3p7gb_

PDB Entry: 3p7g (more details), 1.5 Å

PDB Description: structure of the human langerin carbohydrate recognition domain in complex with mannose
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7gb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
tkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktf
lfickrpyvp

SCOPe Domain Coordinates for d3p7gb_:

Click to download the PDB-style file with coordinates for d3p7gb_.
(The format of our PDB-style files is described here.)

Timeline for d3p7gb_: