Lineage for d3p77a1 (3p77 A:0-177)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.0: automated matches [227140] (1 protein)
not a true familyProtein automated matches [226842] (5 species)
not a true proteinSpecies Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) 
Domain d3p77a1: 3p77 A:0-177 [200203]
Other proteins in same PDB: d3p77a2, d3p77b_
automated match to d1de4a2
complexed with 2pe, act, pge
Details for d3p77a1
PDB Entry: 3p77 (more details), 1.6 Å
PDB Description: Crystal Structures of the Chicken YF1*7.1 molecule
PDB Compounds: (A:) MHC Rfp-Y class I alpha chainSCOPe Domain Sequences for d3p77a1:
Sequence, based on SEQRES records: (download)
>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd
tqtqkaqggerdfdwnlnrlperynkskgshtmqmmfgcdiledgsirgydqyafdgrdf
lafdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk
Sequence, based on observed residues (ATOM records): (download)
>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd
tqtqkaqggerdfdwnlnrlperynkgshtmqmmfgcdiledgsirgydqyafdgrdfla
fdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk
SCOPe Domain Coordinates for d3p77a1:
Click to download the PDB-style file with coordinates for d3p77a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p77a1:
- d3p77a1 first appeared in SCOPe 2.03
- d3p77a1 appears in SCOPe 2.07
View in 3D
