Lineage for d3p57j_ (3p57 J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963102Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2963103Superfamily d.88.1: SRF-like [55455] (2 families) (S)
  5. 2963104Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2963141Protein automated matches [191130] (2 species)
    not a true protein
  7. 2963142Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries)
  8. 2963143Domain d3p57j_: 3p57 J: [196251]
    automated match to d3kova_
    protein/DNA complex; complexed with zn

Details for d3p57j_

PDB Entry: 3p57 (more details), 2.19 Å

PDB Description: crystal structure of the p300 taz2 domain bound to mef2 on dna
PDB Compounds: (J:) myocyte-specific enhancer factor 2a

SCOPe Domain Sequences for d3p57j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p57j_ d.88.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk

SCOPe Domain Coordinates for d3p57j_:

Click to download the PDB-style file with coordinates for d3p57j_.
(The format of our PDB-style files is described here.)

Timeline for d3p57j_: