Lineage for d3p54a2 (3p54 A:300-404)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamiliesFamily b.1.18.0: automated matches [191341] (1 protein)
not a true familyProtein automated matches [190226] (43 species)
not a true protein
Species Japanese encephalitis virus [TaxId:11072] [226037] (1 PDB entry) 
Domain d3p54a2: 3p54 A:300-404 [214663]
Other proteins in same PDB: d3p54a1
automated match to d1urza1
Details for d3p54a2
PDB Entry: 3p54 (more details), 2.1 Å
PDB Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.
PDB Compounds: (A:) Envelope glycoproteinSCOPe Domain Sequences for d3p54a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p54a2 b.1.18.0 (A:300-404) automated matches {Japanese encephalitis virus [TaxId: 11072]}
tygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnp
fvatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlg
SCOPe Domain Coordinates for d3p54a2:
Click to download the PDB-style file with coordinates for d3p54a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3p54a2:
- d3p54a2 first appeared in SCOPe 2.03
- d3p54a2 appears in SCOPe 2.04
- d3p54a2 appears in SCOPe 2.06
- d3p54a2 appears in the current release, SCOPe 2.08
View in 3D
