SCOPe 2.08: Domain d3p05b2: 3p05 B:148-219

Lineage for d3p05b2 (3p05 B:148-219)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-down
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)
Family a.28.3.0: automated matches [191629] (1 protein)
not a true family
Protein automated matches [191156] (12 species)
not a true protein
Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
Domain d3p05b2: 3p05 B:148-219 [233182]
Other proteins in same PDB: d3p05a1, d3p05b1, d3p05c1, d3p05d1, d3p05e1
automated match to d1e6jp1
complexed with iod

Details for d3p05b2

PDB Entry: 3p05 (more details), 2.5 Å

PDB Description: X-ray structure of pentameric HIV-1 CA

PDB Compounds: (B:) hiv-1 ca

SCOPe Domain Sequences for d3p05b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p05b2 a.28.3.0 (B:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

SCOPe Domain Coordinates for d3p05b2:

Click to download the PDB-style file with coordinates for d3p05b2.
(The format of our PDB-style files is described here.)

Timeline for d3p05b2: