Lineage for d3ot1b_ (3ot1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859508Species Vibrio cholerae [TaxId:243277] [189482] (2 PDB entries)
  8. 2859510Domain d3ot1b_: 3ot1 B: [183277]
    automated match to d2ab0a1
    complexed with cl, na

Details for d3ot1b_

PDB Entry: 3ot1 (more details), 1.16 Å

PDB Description: crystal structure of vc2308 protein
PDB Compounds: (B:) 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme

SCOPe Domain Sequences for d3ot1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ot1b_ c.23.16.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
mskrilvpvahgseemetviivdtlvragfqvtmaavgdklqvqgsrgvwltaeqtleac
saeafdalalpggvggaqafadstallalidafsqqgklvaaicatpalvfakqqkfvga
rmtchpnffdhipserlsrqrvcyyatqhlltsqgpgtalefalamiallagvelaqhva
apmvlhpqqltelsgf

SCOPe Domain Coordinates for d3ot1b_:

Click to download the PDB-style file with coordinates for d3ot1b_.
(The format of our PDB-style files is described here.)

Timeline for d3ot1b_: