Lineage for d3oscb_ (3osc B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610777Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1610778Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1611163Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1611164Protein automated matches [190891] (23 species)
    not a true protein
  7. 1611175Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)
  8. 1611194Domain d3oscb_: 3osc B: [248324]
    automated match to d2aeeb_
    complexed with peg, prp

Details for d3oscb_

PDB Entry: 3osc (more details), 2.65 Å

PDB Description: 2.65 Angstrom resolution crystal structure of an orotate phosphoribosyltransferase from Bacillus anthracis str. 'Ames Ancestor' in complex with 5-phospho-alpha-D-ribosyl diphosphate (PRPP)
PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3oscb_:

Sequence, based on SEQRES records: (download)

>d3oscb_ c.61.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
nlyfqsnamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaa
gleelikehfptveviagtatagiahaawvsdrmdlpmcyvrskakghgkgnqiegkaek
gqkvvvvedlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasysls
dysaltevaaekgiigqaetkklqewrknpadeawita

Sequence, based on observed residues (ATOM records): (download)

>d3oscb_ c.61.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 261594]}
nlyfqsnamkkeiashlleigavflqpndpftwssgmkspiycdnrltlsypkvrqtiaa
gleelikehfptveviagtatagiahaawvsdrmdlpmcyvrsgnqiegkaekgqkvvvv
edlistggsaitcvealreagcevlgivsiftyeleagkekleaanvasyslsdysalte
vaaekgiigqaetkklqewrknpadeawita

SCOPe Domain Coordinates for d3oscb_:

Click to download the PDB-style file with coordinates for d3oscb_.
(The format of our PDB-style files is described here.)

Timeline for d3oscb_:

  • d3oscb_ is new in SCOPe 2.04-stable
  • d3oscb_ does not appear in SCOPe 2.05