Lineage for d3orya1 (3ory A:-3-224)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.120: PIN domain-like [88722] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145Superfamily c.120.1: PIN domain-like [88723] (4 families) 
Family c.120.1.0: automated matches [227267] (1 protein)
not a true familyProtein automated matches [227060] (2 species)
not a true proteinSpecies Desulfurococcus amylolyticus [TaxId:94694] [226071] (1 PDB entry) 
Domain d3orya1: 3ory A:-3-224 [214512]
Other proteins in same PDB: d3orya2
automated match to d1b43a2
complexed with po4
Details for d3orya1
PDB Entry: 3ory (more details), 2 Å
PDB Description: Crystal structure of Flap endonuclease 1 from hyperthermophilic archaeon Desulfurococcus amylolyticus
PDB Compounds: (A:) flap endonuclease 1SCOPe Domain Sequences for d3orya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orya1 c.120.1.0 (A:-3-224) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]}
gvdmgvdlkdiipgeaktviedlrilhgkiividgynalyqflaairqpdgtplmdnngr
itshlsglfyrtiniveagikpvyvfdgkppelkareierrkavkeeaakkyeeavqsgd
lelarryammsaklteemvrdakslldamgipwvqapaegeaqaayivkkgdayasasqd
ydsllfgspklvrnltisgrrklprkneyvevkpelieldkllvqlg
SCOPe Domain Coordinates for d3orya1:
Click to download the PDB-style file with coordinates for d3orya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3orya1:
- d3orya1 first appeared in SCOPe 2.03
- d3orya1 appears in SCOPe 2.07
View in 3D
