Lineage for d3oq2b_ (3oq2 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. Protein automated matches [190980] (6 species)
    not a true protein
  7. Species Desulfovibrio vulgaris [TaxId:882] [267863] (1 PDB entry)
  8. Domain d3oq2b_: 3oq2 B: [265119]
    automated match to d4qr0a_
    complexed with cit, cl, na, so4, trs

Details for d3oq2b_

PDB Entry: 3oq2 (more details), 1.35 Å

PDB Description: structure of a crispr associated protein cas2 from desulfovibrio vulgaris
PDB Compounds: (B:) CRISPR-associated protein Cas2

SCOPe Domain Sequences for d3oq2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oq2b_ d.58.58.0 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
mygndamlvlisydvsfedpggqrrlrriakacqdygqrvqysvfecvvdpaqwaklkhr
llsemdkekdclrfyylganwrnkvehvgakpaydpegplil

SCOPe Domain Coordinates for d3oq2b_ are not available.

Timeline for d3oq2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3oq2a_