Lineage for d3op4a_ (3op4 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
has additional subdomain(s) that are not in the common domain
Protein automated matches [190085] (59 species)
not a true protein
Species Vibrio cholerae [TaxId:243277] [189479] (8 PDB entries) 
Domain d3op4a_: 3op4 A: [183217]
automated match to d1q7ba_
complexed with act, nap
Details for d3op4a_
PDB Entry: 3op4 (more details), 1.6 Å
PDB Description: crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductaseSCOPe Domain Sequences for d3op4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3op4a_ c.2.1.2 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
nggmymi
SCOPe Domain Coordinates for d3op4a_:
Click to download the PDB-style file with coordinates for d3op4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3op4a_:
- d3op4a_ first appeared in SCOPe 2.01
- d3op4a_ appears in SCOPe 2.07
View in 3D
