Lineage for d3omub_ (3omu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973760Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)
  8. 2973764Domain d3omub_: 3omu B: [196407]
    Other proteins in same PDB: d3omua2
    automated match to d3o6oa_
    complexed with ibd

Details for d3omub_

PDB Entry: 3omu (more details), 2.15 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of a thienopyrimidine derivative
PDB Compounds: (B:) Heat shock protein 83

SCOPe Domain Sequences for d3omub_:

Sequence, based on SEQRES records: (download)

>d3omub_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielm

Sequence, based on observed residues (ATOM records): (download)

>d3omub_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdhlr
irvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfgvg
fysaylvadrvtvvsknneddaytwesgtftvtstpdcdlkrgtrivlhlkedqqeylee
rrlkdlikkhsigydielm

SCOPe Domain Coordinates for d3omub_:

Click to download the PDB-style file with coordinates for d3omub_.
(The format of our PDB-style files is described here.)

Timeline for d3omub_: