Lineage for d3om8b_ (3om8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871537Species Pseudomonas aeruginosa [TaxId:208964] [189478] (7 PDB entries)
  8. 1871545Domain d3om8b_: 3om8 B: [183167]
    automated match to d1va4a_
    complexed with edo, mes

Details for d3om8b_

PDB Entry: 3om8 (more details), 2.25 Å

PDB Description: The crystal structure of a hydrolase from Pseudomonas aeruginosa PA01
PDB Compounds: (B:) Probable hydrolase

SCOPe Domain Sequences for d3om8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om8b_ c.69.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
nagnlsflatsdgaslayrldgaaekpllalsnsigttlhmwdaqlpaltrhfrvlryda
rghgassvppgpytlarlgedvlelldalevrrahflglslggivgqwlalhapqrierl
vlantsawlgpaaqwderiaavlqaedmsetaagflgnwfppalleraepvverframlm
atnrhglagsfaavrdtdlraqlarierptlviagaydtvtaashgeliaasiagarlvt
lpavhlsnvefpqafegavlsflga

SCOPe Domain Coordinates for d3om8b_:

Click to download the PDB-style file with coordinates for d3om8b_.
(The format of our PDB-style files is described here.)

Timeline for d3om8b_: