Lineage for d3okka2 (3okk A:108-215)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) 
Domain d3okka2: 3okk A:108-215 [214412]
Other proteins in same PDB: d3okka1, d3okkb_
automated match to d1eapa2
complexed with zn
Details for d3okka2
PDB Entry: 3okk (more details), 1.95 Å
PDB Description: crystal structure of s25-39 in complex with kdo(2.4)kdo
PDB Compounds: (A:) S25-39 Fab (IgG1k) light chainSCOPe Domain Sequences for d3okka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3okka2 b.1.1.2 (A:108-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserangvlnswtdqd
skdstysmtstltltkdeyerhnsytceashktstspivksfnrnecx
SCOPe Domain Coordinates for d3okka2:
Click to download the PDB-style file with coordinates for d3okka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3okka2:
- d3okka2 first appeared in SCOPe 2.03
- d3okka2 appears in SCOPe 2.07
View in 3D
