Lineage for d3ojvc1 (3ojv C:147-249)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367889Domain d3ojvc1: 3ojv C:147-249 [214401]
    Other proteins in same PDB: d3ojva_, d3ojvb_
    automated match to d1djsa1

Details for d3ojvc1

PDB Entry: 3ojv (more details), 2.6 Å

PDB Description: crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop
PDB Compounds: (C:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3ojvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojvc1 b.1.1.0 (C:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrmpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggy
kvryatwsiimdsvvpsdkgnytciveneygsinhtyqldvve

SCOPe Domain Coordinates for d3ojvc1:

Click to download the PDB-style file with coordinates for d3ojvc1.
(The format of our PDB-style files is described here.)

Timeline for d3ojvc1:

2367889
d3ojvc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3ojvc2