Lineage for d3od3a3 (3od3 A:336-516)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381153Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2381154Species Escherichia coli [TaxId:562] [69195] (38 PDB entries)
  8. 2381181Domain d3od3a3: 3od3 A:336-516 [214317]
    automated match to d1n68a3
    complexed with cu, edo, o

Details for d3od3a3

PDB Entry: 3od3 (more details), 1.1 Å

PDB Description: cueo at 1.1 a resolution including residues in previously disordered region
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3od3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3od3a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

SCOPe Domain Coordinates for d3od3a3:

Click to download the PDB-style file with coordinates for d3od3a3.
(The format of our PDB-style files is described here.)

Timeline for d3od3a3: