Lineage for d3obba1 (3obb A:163-296)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006477Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 2006488Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 2006491Species Pseudomonas aeruginosa [TaxId:287] [158733] (2 PDB entries)
    Uniprot Q9I5I6 163-296
  8. 2006492Domain d3obba1: 3obb A:163-296 [182914]
    Other proteins in same PDB: d3obba2
    complexed with act, edo, epe

Details for d3obba1

PDB Entry: 3obb (more details), 2.2 Å

PDB Description: crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1
PDB Compounds: (A:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3obba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obba1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

SCOPe Domain Coordinates for d3obba1:

Click to download the PDB-style file with coordinates for d3obba1.
(The format of our PDB-style files is described here.)

Timeline for d3obba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3obba2