Lineage for d3oaha_ (3oah A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823027Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins)
    automatically mapped to Pfam PF00740
  6. 2823053Protein automated matches [190920] (12 species)
    not a true protein
  7. 2823072Species Adeno-associated virus - 6 [TaxId:68558] [254925] (5 PDB entries)
  8. 2823073Domain d3oaha_: 3oah A: [248153]
    automated match to d1lp3a_
    complexed with cyt, oah

Details for d3oaha_

PDB Entry: 3oah (more details), 3 Å

PDB Description: Structural Characterization of the Dual Glycan Binding Adeno-Associated Virus Serotype 6
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d3oaha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oaha_ b.121.5.2 (A:) automated matches {Adeno-associated virus - 6 [TaxId: 68558]}
adgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgys
tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiannl
tstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycle
yfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylnrtqnqsgsaq
nkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngresi
inpgtamashkddkdkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvaterf
gtvavnlqssstdpatgdvhvmgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmgg
fglkhpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwnp
evqytsnyaksanvdftvdnnglyteprpigtryltrpl

SCOPe Domain Coordinates for d3oaha_:

Click to download the PDB-style file with coordinates for d3oaha_.
(The format of our PDB-style files is described here.)

Timeline for d3oaha_: