Lineage for d3o8xd1 (3o8x D:2-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290480Domain d3o8xd1: 3o8x D:2-112 [200020]
    Other proteins in same PDB: d3o8xa1, d3o8xa2, d3o8xb_, d3o8xc1, d3o8xc2, d3o8xd2
    automated match to d1lp9f1
    complexed with gsl, nag

Details for d3o8xd1

PDB Entry: 3o8x (more details), 2.74 Å

PDB Description: recognition of glycolipid antigen by inkt cell tcr
PDB Compounds: (D:) Vbeta8.2 chimera (Mouse variable domain, Human T-cell receptor beta-2 chain C region constant domain)

SCOPe Domain Sequences for d3o8xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o8xd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d3o8xd1:

Click to download the PDB-style file with coordinates for d3o8xd1.
(The format of our PDB-style files is described here.)

Timeline for d3o8xd1: